SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000372160 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000372160
Domain Number 1 Region: 131-260
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-35
Family Phosphotyrosine-binding domain (PTB) 0.0000284
Further Details:      
 
Domain Number 2 Region: 7-110
Classification Level Classification E-value
Superfamily PH domain-like 1.67e-17
Family Phosphotyrosine-binding domain (PTB) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000372160   Gene: ENSG00000206052   Transcript: ENST00000382713
Sequence length 331
Comment pep:known chromosome:GRCh38:18:69401055:69849087:1 gene:ENSG00000206052 transcript:ENST00000382713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNFNDIVKQGYVKIRSRKLGIFRRCWLVFKKASSKGPRRLEKFPDEKAAYFRNFHKVT
ELHNIKNITRLPRETKKHAVAIIFHDETSKTFACESELEAEEWCKHLCMECLGTRLNDIS
LGEPDLLAAGVQREQNERFNVYLMPTPNLDIYGECTMQITHENIYLWDIHNAKVKLVMWP
LSSLRRYGRDSTWFTFESGRMCDTGEGLFTFQTREGEMIYQKVHSATLAIAEQHERLMLE
MEQKARLQTSLTEPMTLSKSISLPRSAYWHHITRQNSVGEIYSLQGHGFGSSKMSRAQTF
PSYAPEQSEEAQQPLSRSSSYGFSYSSSLIQ
Download sequence
Identical sequences A0A2I3M878 A0A2K5N875 A0A2K5W216 A0A2K6CIZ2 F7BCD1 G1RCZ4 G3QLB4 H2NWJ5 H2R6P9 Q6PKX4
ENSMMUP00000041156 ENSPTRP00000049345 ENSNLEP00000011093 gi|47575849|ref|NP_689934.2| ENSP00000372160 ENSPPYP00000010359 ENSNLEP00000011093 ENSP00000372160 ENSPPYP00000010359 9598.ENSPTRP00000049345 9600.ENSPPYP00000010359 9606.ENSP00000372160 ENSPTRP00000049345 NP_001252967.1.72884 NP_689934.2.87134 NP_689934.2.92137 XP_003264376.1.23891 XP_005586539.1.63531 XP_008012009.1.81039 XP_011731560.1.29376 XP_011823742.1.47321 XP_011924599.1.92194 XP_018869795.1.27298 XP_512169.2.37143 ENSP00000372160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]