SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000380570 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000380570
Domain Number 1 Region: 1-384
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.18e-108
Family Cystathionine synthase-like 0.000000000945
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000380570   Gene: ENSG00000244005   Transcript: ENST00000397425
Sequence length 397
Comment pep:putative chromosome:GRCh38:20:35668983:35699349:-1 gene:ENSG00000244005 transcript:ENST00000397425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVQATTPLDPRVLDAMLPYLINYYGNPHSRTHAYGWESEAAMERARQQVASLIGADPRE
IIFTSGATESNNIAIKGVARFYRSRKKHLITTQTEHKCVLDSCRSLEAEGFQVTYLPVQK
SGIIDLKELEAAIQPDTSLVSVMTVNNEIGVKQPIAEIGRICSSRKVYFHTDAAQAVGKI
PLDVNDMKIDLMSISGHKIYGPKGVGAIYIRRRPRVRVEALQSGGGQERGMRSGTVPTPL
VVGLGAACEVAQQEMEYDHKRISKLSERLIQNIMKSLPDVVMNGDPKHHYPGCINLSFAY
VEGESLLMALKDVALSSGSACTSASLEPSYVLRAIGTDEDLAHSSIRFGIGRFTTEEEVD
YTVEKCIQHVKRLREMSPLWEMVQDGIDLKSIKWTQH
Download sequence
Identical sequences A0A2J8JYR8 Q5QP19
XP_009435383.1.37143 XP_016802601.1.37143 ENSP00000363198 ENSP00000380570 ENSP00000363198 ENSP00000380570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]