SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000382151 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000382151
Domain Number 1 Region: 9-139
Classification Level Classification E-value
Superfamily RUN domain-like 2.62e-30
Family RUN domain 0.00000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000382151   Gene: ENSG00000204130   Transcript: ENST00000399200
Sequence length 403
Comment pep:known chromosome:GRCh38:10:68377194:68407294:-1 gene:ENSG00000204130 transcript:ENST00000399200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATKDPTAVERANLLNMAKLSIKGLIESALSFGRTLDSDYPPLQQFFVVMEHCLKHGLKV
RKSFLSYNKTIWGPLELVEKLYPEAEEIGASVRDLPGLNEFYEYHALMMEEEGAVIVGLL
VGLNVIDANLCVKGEDLDSQVGVIDFSMYLKNEEDIGNKERNVQIAAILDQKNYVEELNR
QLNSTVSSLHSRVDSLEKSNTKLIEELAIAKNNIIKLQEENHQLRSENKLILMKTQQHLE
VTKVDVETELQTYKHSRQGLDEMYNEARRQLRDESQLRQDVENELAVQVSMKHEIELAMK
LLEKDIHEKQDTLIGLRQQLEEVKAINIEMYQKLQGSEDGLKEKNEIIARLEEKTNKITA
AMRQLEQSDNDLLTQTRTIAMSLVKCASSDTQDQYKLVKDISF
Download sequence
Identical sequences A0A2I3TWQ7 A0A2K6R9Q5 F7CAF8 F7I3Y7
gi|109240552|ref|NP_001035882.1| ENSP00000382151 ENSCJAP00000035537 ENSP00000382151 NP_001035882.1.87134 NP_001035882.1.92137 XP_007961459.1.81039 XP_008954027.1.60992 XP_010373571.1.97406 XP_016773910.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]