SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000383023 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000383023
Domain Number 1 Region: 27-168
Classification Level Classification E-value
Superfamily EF-hand 5.99e-36
Family Calmodulin-like 0.00000987
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000383023   Gene: ENSG00000215375   Transcript: ENST00000400159
Sequence length 173
Comment pep:known chromosome:GRCh38:4:677922:682033:1 gene:ENSG00000215375 transcript:ENST00000400159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYA
SLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKI
NKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE
Download sequence
Identical sequences Q02045
gi|4505305|ref|NP_002468.1| ENSP00000383023 NP_002468.1.87134 NP_002468.1.92137 XP_016863734.1.92137 XP_016863735.1.92137 ENSP00000423118 ENSP00000383023 9606.ENSP00000383023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]