SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000384499 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000384499
Domain Number 1 Region: 1104-1188
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-27
Family SH3-domain 0.00000321
Further Details:      
 
Domain Number 2 Region: 230-332
Classification Level Classification E-value
Superfamily EF-hand 2.89e-27
Family Eps15 homology domain (EH domain) 0.0028
Further Details:      
 
Domain Number 3 Region: 8-107
Classification Level Classification E-value
Superfamily EF-hand 4.33e-26
Family Eps15 homology domain (EH domain) 0.0019
Further Details:      
 
Domain Number 4 Region: 758-841
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-21
Family SH3-domain 0.00000526
Further Details:      
 
Domain Number 5 Region: 869-958
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-19
Family SH3-domain 0.0000161
Further Details:      
 
Domain Number 6 Region: 980-1041
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-19
Family SH3-domain 0.0000294
Further Details:      
 
Domain Number 7 Region: 1049-1119
Classification Level Classification E-value
Superfamily SH3-domain 7.09e-16
Family SH3-domain 0.0000201
Further Details:      
 
Domain Number 8 Region: 1190-1236
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000000432
Family DBL homology domain (DH-domain) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000384499   Gene: ENSG00000198399   Transcript: ENST00000406921
Sequence length 1249
Comment pep:putative chromosome:GRCh38:2:24220319:24360508:-1 gene:ENSG00000198399 transcript:ENST00000406921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAQFPTAMNGGPNMWAITSEERTKHDRQFDNLKPSGGYITGDQARNFFLQSGLPAPVLA
EIWALSDLNKDGKMDQQEFSIAMKLIKLKLQGQQLPVVLPPIMKQPPMFSPLISARFGMG
SMPNLSIPQPLPPAAPITSLSSATSGTNLPPLMMPTPLVPSVSTSSLPNGTASLIQPLPI
PYSSSTLPHGSSYSLMMGGFGGASIQKAQSLIDLGSSSSTSSTASLSGNSPKTGTSEWAV
PQPTRLKYRQKFNTLDKSMSGYLSGFQARNALLQSNLSQTQLATIWTLADVDGDGQLKAE
EFILAMHLTDMAKAGQPLPLTLPPELVPPSFRGGKQIDSINGTLPSYQKMQEEEPQKKLP
VTFEDKRKANYERGNMELEKRRQALMEQQQREAERKAQKEKEEWERKQRELQEQEWKKQL
ELEKRLEKQRELERQREEERRKDIERREAAKQELERQRRLEWERIRRQELLNQKNREQEE
IVRLNSKKKNLHLELEALNGKHQQISGRLQDVRLKKQTQKTELEVLDKQCDLEIMEIKQL
QQELQEYQNKLIYLVPEKQLLNERIKNMQFSNTPDSGVSLLHKKSLEKEELCQRLKEQLD
ALEKETASKLSEMDSFNNQLKCGNMDDSVLQCLLSLLSCLNNLFLLLKELRETYNTQQLA
LEQLYKIKRDKLKEIERKRLELMQKKKLEDEAARKAKQGKENLWKENLRKEEEEKQKRLQ
EEKTQEKIQEEERKAEEKQRKDKDTLKAEEKKRETASVLVNYRALYPFEARNHDEMSFNS
GDIIQVDEKTVGEPGWLYGSFQGNFGWFPCNYVEKMPSSENEKAVSPKKALLPPTVSLSA
TSTSSEPLSSNQPASVTDYQNVSFSNLTVNTSWQKKSAFTRTVSPGSVSPIHGQGQVVEN
LKAQALCSWTAKKDNHLNFSKHDIITVLEQQENWWFGEVHGGRGWFPKSYVKIIPGSEVK
REEPEALYAAVNKKPTSAAYSVGEEYIALYPYSSVEPGDLTFTEGEEILVTQKDGEWWTG
SIGDRSGIFPSNYVKPKDQESFGSASKSGASNKKPEIAQVTSAYVASGSEQLSLAPGQLI
LILKKNTSGWWQGELQARGKKRQKGWFPASHVKLLGPSSERATPAFHPVCQVIAMYDYAA
NNEDELSFSKGQLINVMNKDDPDWWQGEINGVTGLFPSNYVKMTTDSDPSQQWCADLQTL
DTMQPIERKRQGYIHELIQTEERYMADLQLVVEVRRLLLASSRGICCLS
Download sequence
Identical sequences NP_671494.2.87134 NP_671494.2.92137 ENSP00000384499 ENSP00000384499 gi|194294525|ref|NP_671494.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]