SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000386549 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000386549
Domain Number 1 Region: 4-121
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.97e-16
Family SepSecS-like 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386549   Gene: ENSG00000166224   Transcript: ENST00000409118
Sequence length 135
Comment pep:known chromosome:GRCh38:10:70854706:70859605:1 gene:ENSG00000166224 transcript:ENST00000409118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMDAFWQEGRAS
GTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDSCGCV
SICKGHPIALFFRLK
Download sequence
Identical sequences H0Y3V8
ENSP00000386549 ENSP00000386549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]