SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000387020 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000387020
Domain Number 1 Region: 261-437
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-24
Family DBL homology domain (DH-domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387020   Gene: ENSG00000214694   Transcript: ENST00000409978
Sequence length 870
Comment pep:putative chromosome:GRCh38:2:38889880:38975449:1 gene:ENSG00000214694 transcript:ENST00000409978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKTKTKQGENEHMPVNNPSTQIYQLQALASELKTGFTEAMQELSRIQHGEYALEEKVKS
CRCSMEEKVTEMKNSLNYFKEELSNAMSMIQAITSKQEEMQQKIEQLQQEKRRESRKVKA
KKTQKEEHSSQAGPAQAQGSPFRSINIPEPVLPSEDFTNLLPSQAYEKAQESRSVHVGDS
NVKGMMGPGVNPTTPEAEENLKSCLSADIQSKGHLPSGMWRQPKDGKEWGEEYVTKDHPD
KLKEAGQGRHSSLENVLCETSLAAKRQTVALELLESERKYVINISLILKIKATFQGSDGK
RNSKERSLFPGSLRYLVQQHLDLLHALQERVLKWPRQGVLGDLFLKLTNDENNFLDYYVA
YLRDLPECISLVHVVVLKEGDEEIKSDIYTLFFHIVQRIPEYLIHLQNVLKFTEQEHPDY
YLLLVCVQRLRVFISHYTLLFQCNEDLLIQKRKKLKKSSMAKLYKGLASQCANAGQDASP
TAGPEAVRDTGIHSEELLQPYPSAPSSGPAITHLMPPVKKSQQQQSLMESMQPGKPSDWE
LEGRKHERPESLLAPTQFCAAEQDVKALAGPLQAIPEMDFESSPAEPLGNVERSLRAPAE
LLPDARGFVPAAYEEFEYGGEIFALPAPYDEEPFQAPALFENCSPASSESSLDICFLRPV
SFAMEAERPEHPLQPLPKSATSPAGSSSAYKLEAAAQAHGKAKPLSRSLKEFPRAPPADG
VAPRLYSTRSSSGGRAPIKAERAAQAHGPAAAAVAARGASRTFFPQQRSQSEKQTYLEVR
REMHLEDTTRFCPKEERESEQTSFSDQNPRQDQKGGFRSSFRKLFKKKSSGSEYREKTNE
NPSMDPSPTKQDFFRNRLALANDLDQGTAV
Download sequence
Identical sequences ENSP00000381780 ENSP00000387020 ENSP00000381780 ENSP00000387020 NP_001138923.2.87134 NP_001138923.2.92137 ENSP00000381780 gi|290463441|ref|NP_001138923.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]