SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000387162 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000387162
Domain Number 1 Region: 27-307
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.34e-64
Family Cystathionine synthase-like 0.0000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387162   Gene: ENSG00000132330   Transcript: ENST00000409736
Sequence length 317
Comment pep:known chromosome:GRCh38:2:238061031:238092083:1 gene:ENSG00000132330 transcript:ENST00000409736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAVAPGRDAPAPAASQPSGCGKHNSPERKVYMDYNATTPLEPEVIQAMTKAMWEAWGN
PSSPYSAGRKAKDIINAARESLAKMIGGKPQDIIFTSGGTESNNLVIHSVVKHFHANQTS
KGHTGGHHSPVKGAKPHFITSSVEHDSIRLPLEHLVEEQVAAVTFVPVSKVSGQAEVDDI
LAAVRPTTRLVTIMLANNETGIVMPVPEISQRIKALNQERVAAGLPPILVHTDAAQALGK
QRVDVEDLGVDFLTIVGHKFYGPRIGALYIRGLGEFTPLYPMLFGGGQERNFRPGTENTP
MIAGLGKVSPGELEEMS
Download sequence
Identical sequences ENSP00000387162 ENSP00000387162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]