SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000387165 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000387165
Domain Number 1 Region: 636-816
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.54e-47
Family Ypt/Rab-GAP domain of gyp1p 0.0025
Further Details:      
 
Domain Number 2 Region: 794-897
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.97e-26
Family Ypt/Rab-GAP domain of gyp1p 0.0065
Further Details:      
 
Domain Number 3 Region: 33-145
Classification Level Classification E-value
Superfamily PH domain-like 5.48e-18
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Weak hits

Sequence:  ENSP00000387165
Domain Number - Region: 247-280
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00863
Family KRAB domain (Kruppel-associated box) 0.0041
Further Details:      
 
Domain Number - Region: 488-550
Classification Level Classification E-value
Superfamily Tropomyosin 0.0183
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387165   Gene: ENSG00000167202   Transcript: ENST00000409931
Sequence length 914
Comment pep:known chromosome:GRCh38:15:77994986:78077724:-1 gene:ENSG00000167202 transcript:ENST00000409931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGAGARAEEGGGGGEGAAQGAAAEPGAGPAREPARLCGYLQKLSGKGPLRGYRSRWFVF
DARRCYLYYFKSPQDALPLGHLDIADACFSYQGPDEAAEPGTEPPAHFQVHSAGAVTVLK
APNRQLMTYWLQELQQKRWEYCNSLDMVKWDSRTSPTPGDFPKGLVARDNTDLIYPHPNA
SAEKARNVLAVETVPGELVGEQAANQPAPGHPNSINFYSLKQWGNELKNSMSSFRPGRGH
NDSRRTVFYTNEEWELLDPTPKDLEESIVQEEKKKLTPEGNKGVTGSGFPFDFGRNPYKG
KRPLKDIIGSYKNRHSSGDPSSEGTSGSGSVSIRKPASEMQLQVQSQQEELEQLKKDLSS
QKELVRLLQQTVRSSQYDKYFTSSRLCEGVPKDTLELLHQKDDQILGLTSQLERFSLEKE
SLQQEVRTLKSKVGELNEQLGMLMETIQAKDEVIIKLSEGEGNGPPPTVAPSSPSVVPVA
RDQLELDRLKDNLQGYKTQNKFLNKEILELSALRRNAERRERDLMAKYSSLEAKLCQIES
KYLILLQEMKTPVCSEDQGPTREVIAQLLEDALQVESQEQPEQAFVKPHLVSEYDIYGFR
TVPEDDEEEKLVAKVRALDLKTLYLTENQEVSTGVKWENYFASTVNREMMCSPELKNLIR
AGIPHEHRSKVWKWCVDRHTRKFKDNTEPGHFQTLLQKALEKQNPASKQIELDLLRTLPN
NKHYSCPTSEGIQKLRNVLLAFSWRNPDIGYCQGLNRLVAVALLYLEQEDAFWCLVTIVE
VFMPRDYYTKTLLGSQVDQRVFRDLMSEKLPRLHGHFEQYKVDYTLITFNWFLVVFVDSV
VSDILFKIWDSFLYEGPKVIFRFALALFKYKEEEILKLQDSMSIFKYLRYFTRTILDARS
GTDAPTTWRKSGWS
Download sequence
Identical sequences ENSP00000387165 gi|194018476|ref|NP_055894.6| NP_055894.6.87134 NP_055894.6.92137 ENSP00000387165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]