SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000388151 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000388151
Domain Number 1 Region: 14-130
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.06e-23
Family GABA-aminotransferase-like 0.0000983
Further Details:      
 
Domain Number 2 Region: 185-237
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00000000000268
Family GABA-aminotransferase-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000388151   Gene: ENSG00000100116   Transcript: ENST00000451984
Sequence length 239
Comment pep:novel chromosome:GRCh38:22:37808014:37813609:1 gene:ENSG00000100116 transcript:ENST00000451984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XGRRAQSALAQLRGILEGELEGIRGAGTWKSERVITSRQGPHIRVDGVSGGILNFCANNY
LGLSSHPEVIQAGLQALEEFGAGLSSVRFICGTQSIHKNLEAKIARFHQREDAILYPSCY
DANAGLFESRALVQPGTETRGPQREAQNTLPLYPEERPGWQYSFLICWSPGQGRSPGWLN
DGSTLTASLQALLTPEDAVLSDELNHASIIDGIRLCKAHKYRYRHLDMADLEAKLQEAQ
Download sequence
Identical sequences H7BZ75
ENSP00000388151 ENSP00000388151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]