SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000389422 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000389422
Domain Number 1 Region: 2-355
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.27e-111
Family Pyridoxal-dependent decarboxylase 0.0000000000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000389422   Gene: ENSG00000132437   Transcript: ENST00000430300
Sequence length 361
Comment pep:novel chromosome:GRCh38:7:50458477:50543982:-1 gene:ENSG00000132437 transcript:ENST00000430300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XGYLRPLIPAAAPQEPDTFEDIINDVEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADML
CGAIGCIGFSWAHSSVERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFM
VATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNF
NPHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQIPLGRRFRS
LKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKV
NEALLQRINSAKKIHLVPCHLRDKFVLRFAICSRTVESAHVQRAWEHIKELAADVLRAER
E
Download sequence
Identical sequences H7BZF7
ENSP00000389422 ENSP00000389422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]