SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000390377 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000390377
Domain Number 1 Region: 7-250
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.55e-74
Family AAT-like 0.0000000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000390377   Gene: ENSG00000171097   Transcript: ENST00000451800
Sequence length 251
Comment pep:known chromosome:GRCh38:9:128836009:128882494:-1 gene:ENSG00000171097 transcript:ENST00000451800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFML
NQYTKTFGYPPLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVII
IEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVL
NTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTL
TIGSAGKTFSA
Download sequence
Identical sequences Q5T278
ENSP00000390377 ENSP00000390377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]