SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000391453 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000391453
Domain Number 1 Region: 19-163,208-316
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.74e-35
Family Calponin-homology domain, CH-domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000391453   Gene: ENSG00000138964   Transcript: ENST00000422871
Sequence length 331
Comment pep:known chromosome:GRCh38:22:44172956:44208468:1 gene:ENSG00000138964 transcript:ENST00000422871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPTSRKDPKFEELQKVLMEWINATLLP
EHIVVRSLEEDMFDGLILHHLFQRLAALKLEAEDIALTATSQKHKLTVVLEAVNRSLQLE
EWQAKWSVESIFNKDLLSTLHLLVALAKRFQPDLSLPTNVQVEVITIESTKSGLKSEKLV
EQLTEYSTDKDEPPKDVFDELFKLAPEKVNAVKEAIVNFVNQKLDRLGLSVQNLDTQFAD
GVILLLLIGQLEGFFLHLKEFYLTPNSPAEMLHNVTLALELLKDEGLLSCPVSPEDIVNK
DAKSTLRVLYGLFCKHTQKAHRDRTPHGAPN
Download sequence
Identical sequences A0A024R4U4 Q9HBI0
9606.ENSP00000388613 ENSP00000349378 ENSP00000391453 ENSP00000391583 ENSP00000416761 NP_001131077.1.87134 NP_001131077.1.92137 NP_071424.1.87134 NP_071424.1.92137 XP_005261759.1.92137 ENSP00000391453 ENSP00000391583 GO.33880 gi|11545879|ref|NP_071424.1| gi|212286179|ref|NP_001131077.1| gi|212286181|ref|NP_001131078.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]