SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000392517 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000392517
Domain Number 1 Region: 28-68
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.0000000552
Family Cystathionine synthase-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000392517   Gene: ENSG00000132330   Transcript: ENST00000423324
Sequence length 71
Comment pep:known chromosome:GRCh38:2:238061043:238083303:1 gene:ENSG00000132330 transcript:ENST00000423324 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MEAAVAPGRDAPAPAASQPSGCGKHNSPERKVYMDYNATTPLEPEVIQAMTKAMWEAWGN
PSSPYSAAYSM
Download sequence
Identical sequences F8WCL3
ENSP00000392517 ENSP00000392517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]