SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000393669 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000393669
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.69e-23
Family Cystathionine synthase-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000393669   Gene: ENSG00000244005   Transcript: ENST00000413203
Sequence length 87
Comment pep:known chromosome:GRCh38:20:35681965:35699352:-1 gene:ENSG00000244005 transcript:ENST00000413203 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MDVQATTPLDPRVLDAMLPYLINYYGNPHSRTHAYGWESEAAMERARQQVASLIGADPRE
IIFTSGATESNNIAIKMESHPVAQARV
Download sequence
Identical sequences A0A2J8JYS7 F8WER8
ENSP00000393669 ENSP00000393669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]