SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000393724 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000393724
Domain Number 1 Region: 1-222
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.34e-59
Family Pyridoxal-dependent decarboxylase 0.00000000799
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000393724   Gene: ENSG00000132437   Transcript: ENST00000444733
Sequence length 229
Comment pep:known chromosome:GRCh38:7:50458440:50561054:-1 gene:ENSG00000132437 transcript:ENST00000444733 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDV
EKIIMPGAASPACTELETVMMDWLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLA
ARTKVIHRLQAASPELTQAAIMEKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMR
ASALQEALERDKAAGLIPFFMVATLGTTTCCSFDNLLEVGPIFCRFIQL
Download sequence
Identical sequences F8WER1
ENSP00000393724 ENSP00000393724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]