SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000394100 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000394100
Domain Number 1 Region: 31-386
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.44e-111
Family AAT-like 0.0000000000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000394100   Gene: ENSG00000125166   Transcript: ENST00000434819
Sequence length 387
Comment pep:novel chromosome:GRCh38:16:58707818:58734326:-1 gene:ENSG00000125166 transcript:ENST00000434819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLHSGRVLPGIAAAFHPGLAAAASARASSWWTHVEMGPPDPILGVTEAFKRDTNSKKM
NLGVGAYRDDNGKPYVLPSVRKFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWG
NHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRP
EQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGL
YGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQE
VKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMT
KDGRISVAGVTSSNVGYLAHAIHQVTK
Download sequence
Identical sequences NP_001273149.1.87134 NP_001273149.1.92137 ENSP00000394100 ENSP00000394100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]