SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000395524 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000395524
Domain Number 1 Region: 46-137
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.92e-38
Family SCAN domain 0.0000629
Further Details:      
 
Domain Number 2 Region: 643-700
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.34e-27
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 587-644
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.76e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 531-588
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.04e-24
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 5 Region: 475-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.2e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 7 Region: 685-737
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.75e-21
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 8 Region: 381-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-20
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 9 Region: 224-284
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000458
Family KRAB domain (Kruppel-associated box) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000395524   Gene: ENSG00000196345   Transcript: ENST00000426540
Sequence length 754
Comment pep:known chromosome:GRCh38:3:44555193:44571494:1 gene:ENSG00000196345 transcript:ENST00000426540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTAGRGNLGLIPRSTAFQKQEGRLTVKQEPANQTWGQGSSLQKNYPPVCEIFRLHFRQL
CYHEMSGPQEALSRLRELCRWWLMPEVHTKEQILELLVLEQFLSILPGELRTWVQLHHPE
SGEEAVAVVEDFQRHLSGSEEVSAPAQKQEMHFEETTALGTTKESPPTSPLSGGSAPGAH
LEPPYDPGTHHLPSGDFAQCTSPVPTLPQVGNSGDQAGATVLRMVRPQDTVAYEDLSVDY
TQKKWKSLTLSQRALQWNMMPENHHSMASLAGENMMKGSELTPKQEFFKGSESSNRTSGG
LFGVVPGAAETGDVCEDTFKELEGQTSDEEGSRLENDFLEITDEDKKKSTKDRYDKYKEV
GEHPPLSSSPVEHEGVLKGQKSYRCDECGKAFNRSSHLIGHQRIHTGEKPYECNECGKTF
RQTSQLIVHLRTHTGEKPYECSECGKAYRHSSHLIQHQRLHNGEKPYKCNECAKAFTQSS
RLTDHQRTHTGEKPYECNECGEAFIRSKSLARHQVLHTGKKPYKCNECGRAFCSNRNLID
HQRIHTGEKPYECSECGKAFSRSKCLIRHQSLHTGEKPYKCSECGKAFNQNSQLIEHERI
HTGEKPFECSECGKAFGLSKCLIRHQRLHTGEKPYKCNECGKSFNQNSHLIIHQRIHTGE
KPYECNECGKVFSYSSSLMVHQRTHTGEKPYKCNDCGKAFSDSSQLIVHQRVHTGEKPYE
CSECGKAFSQRSTFNHHQRTHTGEKSSGLAWSVS
Download sequence
Identical sequences Q9P0L1
gi|47716687|ref|NP_061121.2| 9606.ENSP00000273320 ENSP00000273320 ENSP00000395524 ENSP00000273320 ENSP00000395524 ENSP00000345404 NP_001275519.1.87134 NP_001275519.1.92137 NP_061121.2.87134 NP_061121.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]