SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000395608 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000395608
Domain Number 1 Region: 289-389
Classification Level Classification E-value
Superfamily Kringle-like 2.42e-39
Family Kringle modules 0.00000598
Further Details:      
 
Domain Number 2 Region: 509-611
Classification Level Classification E-value
Superfamily Kringle-like 2.15e-38
Family Kringle modules 0.00000194
Further Details:      
 
Domain Number 3 Region: 404-504
Classification Level Classification E-value
Superfamily Kringle-like 5.07e-38
Family Kringle modules 0.00000113
Further Details:      
 
Domain Number 4 Region: 61-164
Classification Level Classification E-value
Superfamily Kringle-like 8.94e-38
Family Kringle modules 0.00000904
Further Details:      
 
Domain Number 5 Region: 175-278
Classification Level Classification E-value
Superfamily Kringle-like 1.09e-37
Family Kringle modules 0.0000152
Further Details:      
 
Domain Number 6 Region: 3-51
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000179
Family Kringle modules 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000395608   Gene: ENSG00000198670   Transcript: ENST00000447678
Sequence length 613
Comment pep:known chromosome:GRCh38:6:160586480:160613115:-1 gene:ENSG00000198670 transcript:ENST00000447678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSE
QAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMN
YCRNPDPVAAPYCYTRDPSVRWEYCNLTQCSDAEGTAVAPPTITPIPSLEAPSEQAPTEQ
RPGVQECYHGNGQSYQGTYFITVTGRTCQAWSSMTPHSHSRTPAYYPNAGLIKNYCRNPD
PVAAPWCYTTDPSVRWEYCNLTRCSDAEWTAFVPPNVILAPSLEAFFEQALTEETPGVQD
CYYHYGQSYRGTYSTTVTGRTCQAWSSMTPHQHSRTPENYPNAGLTRNYCRNPDAEIRPW
CYTMDPSVRWEYCNLTQCLVTESSVLATLTVVPDPSTEASSEEAPTEQSPGVQDCYHGDG
QSYRGSFSTTVTGRTCQSWSSMTPHWHQRTTEYYPNGGLTRNYCRNPDAEISPWCYTMDP
NVRWEYCNLTQCPVTESSVLATSTAVSEQAPTEQSPTVQDCYHGDGQSYRGSFSTTVTGR
TCQSWSSMTPHWHQRTTEYYPNGGLTRNYCRNPDAEIRPWCYTMDPSVRWEYCNLTQCPV
MESTLLTTPTVVP
Download sequence
Identical sequences ENSP00000395608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]