SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000397572 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000397572
Domain Number 1 Region: 58-137
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.15e-24
Family Cystathionine synthase-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000397572   Gene: ENSG00000244005   Transcript: ENST00000456462
Sequence length 147
Comment pep:known chromosome:GRCh38:20:35690413:35699352:-1 gene:ENSG00000244005 transcript:ENST00000456462 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MLLRAAWRRAAVAVTAAPGPKPAAPTRGLRLRVGDRAPQSAVPADTAAAPEVGPVLRPLY
MDVQATTPLDPRVLDAMLPYLINYYGNPHSRTHAYGWESEAAMERARQQVASLIGADPRE
IIFTSGATESNNIAIKMESHPVAQARV
Download sequence
Identical sequences F8WB23
ENSP00000397572 ENSP00000397572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]