SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000399415 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000399415
Domain Number 1 Region: 101-512
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.02e-107
Family AAT-like 0.000000000000588
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000399415   Gene: ENSG00000171097   Transcript: ENST00000436267
Sequence length 516
Comment pep:known chromosome:GRCh38:9:128832942:128882075:-1 gene:ENSG00000171097 transcript:ENST00000436267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRTAAAISVHLVGPLQGRKAGAPLTWFLHQTQVAEKNVGSPAPRPTSHLGLANPQERKV
PQGPQSPCEVPAAEGILRTGGAKLPIQGHPAKLAMAKQLQARRLDGIDYNPWVEFVKLAS
EHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYPPLTKILASFFGELLGQ
EIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKP
GPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQH
DVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIM
KHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQS
VGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYS
VPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVEL
Download sequence
Identical sequences B7Z4W5
ENSP00000399415 ENSP00000399415 ENSP00000412402 NP_001274319.1.87134 NP_001274319.1.92137 XP_016870750.1.92137 XP_016870751.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]