SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000400803 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000400803
Domain Number 1 Region: 11-245
Classification Level Classification E-value
Superfamily L domain-like 8.39e-41
Family Internalin LRR domain 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSP00000400803
Domain Number - Region: 239-276
Classification Level Classification E-value
Superfamily EF2947-like 0.0654
Family EF2947-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000400803   Gene: ENSG00000214954   Transcript: ENST00000448384
Sequence length 347
Comment pep:novel chromosome:GRCh38:8:91102662:91219000:1 gene:ENSG00000214954 transcript:ENST00000448384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTERLLIKALSGGKNTKIITLNGKKMTKMPSALGKLPGLKTLVLQNNLIPKVCPELCNLT
QLTTLNLGNNLLEEVPEEMKYLTSLKNLHLSGNRICRFAPGACDGLQNLILLNLNNNHLT
QLPQEVSRLKSLTYMSINYNQLASIPRELCFLENLVELQLNYNQLICIPEEIKFLKKLQK
LLLARNNIGVLPEELCDLKKLRILDIAGNIIQIFPSGFQDLKLREFYCEGNPLFLQQPVI
STQQENVWSLQEITSRFVMNQLAENNPFLMDDIERYPQVRSMISQGKTCAICGQYFITVW
LECVRFVPPPKDWKISKNLKLVPLQVLICSYKCFTQRDPNLFGIAQV
Download sequence
Identical sequences Q6ZNQ3
gi|193788651|ref|NP_001123362.1| ENSP00000400803 ENSP00000400803 9606.ENSP00000400803 ENSP00000400803 NP_001123362.1.87134 NP_001123362.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]