SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000401401 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000401401
Domain Number 1 Region: 4-107
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.0000000000000117
Family Cystathionine synthase-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000401401   Gene: ENSG00000132330   Transcript: ENST00000433750
Sequence length 122
Comment pep:putative chromosome:GRCh38:2:238083246:238094849:1 gene:ENSG00000132330 transcript:ENST00000433750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XFYGPRIGALYIRGLGEFTPLYPMLFGGGQERNFRPGTENTPMIAGLGKAAELVTQNCEA
YEAHMRDVRDYLEERLEAEFGQKRIHLNSQFPGTQRLPNTCNFSIRGPRLQGDGPSPWSF
RV
Download sequence
Identical sequences H7C1N7
ENSP00000401401 ENSP00000401401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]