SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000402078 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000402078
Domain Number 1 Region: 7-110
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.5e-22
Family Cystathionine synthase-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000402078   Gene: ENSG00000132330   Transcript: ENST00000431487
Sequence length 168
Comment pep:putative chromosome:GRCh38:2:238069457:238083246:1 gene:ENSG00000132330 transcript:ENST00000431487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVEEQVAAVTFVPVSKVSGQAEVDDILAAVRPTTRLVTIMLANNETGIVMPVPEISQRIK
ALNQERVAAGLPPILVHTDAAQALGKQRVDVEDLGVDFLTIVGHKGRAACHRAEHESLAP
ALPPRLGFHPAPKAFVTLRVKRGGTQRRHKEAAGLCIAEHFSCVPLST
Download sequence
Identical sequences H7C1S7
ENSP00000402078 ENSP00000402078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]