SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000403849 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000403849
Domain Number 1 Region: 111-219
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.0000000000000521
Family Pyridoxal-dependent decarboxylase 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000403849   Gene: ENSG00000128683   Transcript: ENST00000414527
Sequence length 233
Comment pep:known chromosome:GRCh38:2:170817038:170859916:1 gene:ENSG00000128683 transcript:ENST00000414527 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLLSCENSDRDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMGRHIQHVQHHGCSLQVLPGS
Download sequence
Identical sequences A0A1D5QPT7 A0A2I2ZCS1 A0A2I3MI44 A0A2I3SMK4 A0A2J8VQR3 A0A2K5IP50 A0A2K5L2G5 A0A2K5VV53 A0A2K5ZTX3 A0A2K6BBX0 F8WD43
ENSP00000403849 ENSP00000403849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]