SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000404473 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000404473
Domain Number 1 Region: 16-145
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.05e-27
Family Cystathionine synthase-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000404473   Gene: ENSG00000132330   Transcript: ENST00000416757
Sequence length 151
Comment pep:putative chromosome:GRCh38:2:238061091:238069836:1 gene:ENSG00000132330 transcript:ENST00000416757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APAASQPSGCGKHNSPERKVYMDYNATTPLEPEVIQAMTKAMWEAWGNPSSPYSAGRKAK
DIINAARESLAKMIGGKPQDIIFTSGGTESNNLVIHSVVKHFHANQTSKGHTGGHHSPVK
GAKPHFITSSVEHDSIRLPLEHLVEEQVAGE
Download sequence
Identical sequences H7C280
ENSP00000404473 ENSP00000404473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]