SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000406703 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000406703
Domain Number 1 Region: 30-374,403-413
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.14e-44
Family Pyridoxal-dependent decarboxylase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000406703   Gene: ENSG00000179889   Transcript: ENST00000455313
Sequence length 429
Comment pep:known chromosome:GRCh38:16:14975080:15029805:1 gene:ENSG00000179889 transcript:ENST00000455313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDASLEKIADPTLAEMGKNLKEAVKMLEDSQRRTEEENGKKLISGDIPGPLQGSGQDMVS
ILQLVQNLMHGDEDEEPQSPRIQNIGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSD
TTLWLCRIFRYENGCAYFHEEEREGLAKICRLAIHSRYEDFVVDGFNVLYNKKPVIYLSA
AARPGLGQYLCNQDVAFLEKLIKDDIERGRLPLLLVANAGTAAVGHTDKIGRLKELCEQY
GIWLHVEGVNLATLALGYVSSSVLAAAKCDSMTMTPGPWLGLPAVPAVTLYKHDDPALTL
VAGLTSNKPTDKLRALPLWLSLQYLGLDGFVERIKHACQLSQRLQESLKKVNYIKILVED
ELSSPVVVFRFFQELPGSDPVFKAVPVPNMTPSGVGRERHSCDALNRWVRMAVTPLSFQV
PVHHHPTCW
Download sequence
Identical sequences NP_001272379.1.87134 NP_001272379.1.92137 ENSP00000406703 ENSP00000406703 ENSP00000479054 ENSP00000481784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]