SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000406719 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000406719
Domain Number 1 Region: 91-169
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.39e-21
Family GABA-aminotransferase-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000406719   Gene: ENSG00000100116   Transcript: ENST00000445195
Sequence length 177
Comment pep:novel chromosome:GRCh38:22:37807916:37813300:1 gene:ENSG00000100116 transcript:ENST00000445195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPGNAWRAALFWVPRGRRAQSALAQLRGILEGELEGIRGAGTWKSERVITSRQGPHIRV
DGVSGGPGTVIFPGLPLPHLSCCIHLLSFTSGILNFCANNYLGLSSHPEVIQAGLQALEE
FGAGLSSVRFICGTQSIHKNLEAKIARFHQREDAILYPSCYDANAGLFESRALVQPG
Download sequence
Identical sequences C9IZC9
ENSP00000406719 ENSP00000406719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]