SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000407350 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000407350
Domain Number 1 Region: 28-134
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000000204
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000407350   Gene: ENSG00000138823   Transcript: ENST00000422897
Sequence length 151
Comment pep:putative chromosome:GRCh38:4:99574824:99584193:1 gene:ENSG00000138823 transcript:ENST00000422897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGKLQDSVGYRIS
SNVDVALLWRNPDGDDDQLIQITMKDVNVENVNQQRGEKSIFKGKSPSKIMGKENLEALQ
RPTLLHLIHGKVKGRLDSTTFSPTSYFSSLQ
Download sequence
Identical sequences ENSP00000407350 ENSP00000407350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]