SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000408826 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000408826
Domain Number 1 Region: 535-685
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.23e-62
Family Ankyrin repeat 0.0000151
Further Details:      
 
Domain Number 2 Region: 32-256,291-316
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.02e-44
Family BAR domain 0.026
Further Details:      
 
Domain Number 3 Region: 419-534
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.96e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.0000119
Further Details:      
 
Domain Number 4 Region: 270-388
Classification Level Classification E-value
Superfamily PH domain-like 6.17e-21
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000408826   Gene: ENSG00000088280   Transcript: ENST00000437606
Sequence length 894
Comment pep:known chromosome:GRCh38:1:23429722:23484179:-1 gene:ENSG00000088280 transcript:ENST00000437606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEQFSVAEFLAVTAEDLSSPAGAAAFAAKMPRYRGAALAREEILEGDQAILQRIKKAVR
AIHSSGLGHVENEEQYREAVESLGNSHLSQNSHELSTGFLNLAVFTREVAALFKNLIQNL
NNIVSFPLDSLMKGQLRDGRQASLSLGSRAKLEKERDRARVTGGIPGEVAQDMQRERRIF
QLHMCEYLLKAGESQMKQGPDFLQSLIKFFHAQHNFFQDGWKAAQSLFPFIEKLAASVHA
LHQAQEDELQKLTQLRDSLRGTLQLESREEHLSRKNSGCGYSIHQHQGNKQFGTEKVGFL
YKKSDGIRRVWQKRKCGVKYGCLTISHSTINRPPVKLTLLTCQVRPNPEEKKCFDLVTHN
RTYHFQAEDEHECEAWVSVLQNSKDEALSSAFLGEPSAGPGSWGSAGHDGEPHDLTKLLI
AEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQSLTLDLLGPS
ELLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTPEPQ
RLWTAICNRDLLSVLEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQASLPLVDFII
QNGGHLDAKAADGNTALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALDIARKKHHKE
CEELLEQAQAGTFAFPLHVDYSWVISTEPGSDSEEDEEEKRCLLKLPAQAHWASGRLDIS
NKTYETVASLGAATPQGESEDCPPPLPVKNSSRTLVQGCARHASGDRSEVSSLSSEAPET
PESLGSPASSSSLMSPLEPGDPSQAPPNSEEGLREPPGTSRPSLTSGTTPSEMYLPVRFS
SESTRSYRRGARSPEDGPSARQPLPRRNVPVGITEGDGSRTGSLPASSVQLLQD
Download sequence
Identical sequences ENSP00000408826 gi|221307473|ref|NP_001137250.1| NP_001137250.1.87134 NP_001137250.1.92137 ENSP00000408826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]