SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000409708 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000409708
Domain Number 1 Region: 54-181,212-329
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.2e-41
Family FAD/NAD-linked reductases, N-terminal and central domains 0.06
Further Details:      
 
Domain Number 2 Region: 619-693
Classification Level Classification E-value
Superfamily EF-hand 2.68e-17
Family Calmodulin-like 0.02
Further Details:      
 
Domain Number 3 Region: 310-404
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000687
Family D-aminoacid oxidase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000409708   Gene: ENSG00000115159   Transcript: ENST00000438166
Sequence length 727
Comment pep:known chromosome:GRCh38:2:156436389:156583058:1 gene:ENSG00000115159 transcript:ENST00000438166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFQKAVKGTILVGGGALATVLGLSQFAHYRRKQMNLAYVKAADCISEPVNREPPSREAQ
LLTLQNTSEFDILVIGGGATGSGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQKAIMKLDIEQYRMVKEALHERANLLEIAPHLSAPLPIMLPVYKWWQLPYYWVGIKLY
DLVAGSNCLKSSYVLSKSRALEHFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYMEVVSLLKKTDPQTGKVRVSGARCKDVLTGQEFDVRAKCVINATGPFTDSVRKM
DDKDAAAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDTPTD
VTHHPIPSEEDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSADTQSISRNH
VVDISESGLITIAGGKWTTYRSMAEDTINAAVKTHNLKAGPSRTVGLFLQGGKDWSPTLY
IRLVQDYGLESEVAQHLAATYGDKAFEVAKMASVTGKRWPIVGVRLVSEFPYIEAEVKYG
IKEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGRELNWDDYKKQEQLETARKFLY
YEMGYKSRSEQLTDRSEISLLPSDIDRYKKRFHKFDADQKGFITIVDVQRVLESINVQMD
ENTLHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPV
DRSCGGL
Download sequence
Identical sequences A0A2J8SUP4 G3RU77 H2R361 P43304
ENSPTRP00000044968 NP_000399.3.87134 NP_000399.3.92137 NP_001076581.2.87134 NP_001076581.2.92137 XP_001143285.1.37143 XP_001143356.1.37143 XP_003832761.1.60992 XP_003832762.1.60992 XP_005246526.1.92137 XP_008956382.1.60992 XP_011509279.1.92137 XP_016859319.1.92137 XP_018878228.1.27298 XP_018878229.1.27298 gi|285002231|ref|NP_001076581.2| gi|285002233|ref|NP_000399.3| ENSP00000386425 9598.ENSPTRP00000044968 9606.ENSP00000308610 ENSP00000308610 ENSP00000386425 ENSP00000386626 ENSP00000409708 ENSPTRP00000044968 ENSP00000308610 ENSP00000386425 ENSP00000386626 ENSP00000409708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]