SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000409760 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000409760
Domain Number 1 Region: 2-116
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.8e-20
Family GABA-aminotransferase-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000409760   Gene: ENSG00000172296   Transcript: ENST00000431275
Sequence length 121
Comment pep:known chromosome:GRCh38:20:13126646:13164471:1 gene:ENSG00000172296 transcript:ENST00000431275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSPPIAEQIIRSLKLIMGLDGTTQGLQRVQQLAKNTRYFRQRLQEMGFIIYGNENASVVP
LLLYMPGKVAAFARHMLEKKIGVVVVGFPATPLAEARARFCVSAAHTREMLDTVICCVMK
I
Download sequence
Identical sequences H0Y733
ENSP00000409760 ENSP00000409760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]