SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000413770 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000413770
Domain Number 1 Region: 26-478
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.51e-282
Family GABA-aminotransferase-like 0.00000000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000413770   Gene: ENSG00000182199   Transcript: ENST00000449049
Sequence length 483
Comment pep:putative chromosome:GRCh38:12:57230360:57234699:1 gene:ENSG00000182199 transcript:ENST00000449049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIRAQHSNAAQTQTGEANRGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCS
RAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDPAQWGVNVQPY
SGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVKRISATSIFFESMPYKLNPKT
GLIDYNQLALTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAA
KVIPSPFKHADIVTTTTHKTLRGARSGLIFYRKGVKAVDPKTGREIPYTFEDRINFAVFP
SLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHL
VLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDF
RRVVDFIDEGVNIGLEVKSKTAKLQDFKSFLLKDSETSQRLANLRQRVEQFARAFPMPGF
DEH
Download sequence
Identical sequences A0A024RB99
ENSP00000406881 ENSP00000413770 ENSP00000452419 NP_001159829.1.87134 NP_001159829.1.92137 NP_001159830.1.87134 NP_001159830.1.92137 NP_001159831.1.87134 NP_001159831.1.92137 ENSP00000406881 ENSP00000413770 ENSP00000452419 gi|261862348|ref|NP_001159829.1| gi|261862350|ref|NP_001159830.1| gi|261862352|ref|NP_001159831.1| 4pvf_A 4pvf_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]