SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000414053 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000414053
Domain Number 1 Region: 3-226
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.6e-41
Family Cystathionine synthase-like 0.0000949
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000414053   Gene: ENSG00000132330   Transcript: ENST00000450965
Sequence length 241
Comment pep:putative chromosome:GRCh38:2:238081735:238099413:1 gene:ENSG00000132330 transcript:ENST00000450965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSGQAEVDDILAAVRPTTRLVTIMLANNETGIVMPVPEISQRIKALNQERVAAGLPPILV
HTDAAQALGKQRVDVEDLGVDFLTIVGHKFYGPRIGALYIRGLGEFTPLYPMLFGGGQER
NFRPGTENTPMIAGLGKAAELVTQNCEAYEAHMRDVRDYLEERLEAEFGQKRIHLNSQFP
GTQRLPNTCNFSIRGPRLQGHVVLAQCRVLMASVGAACHSDHGDHSSCSSVSPSPGRPQC
C
Download sequence
Identical sequences H7C3V9
ENSP00000414053 ENSP00000414053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]