SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000416344 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000416344
Domain Number 1 Region: 29-111
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.95e-22
Family Cystathionine synthase-like 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSP00000416344
Domain Number - Region: 112-188
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.0189
Family Cystathionine synthase-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000416344   Gene: ENSG00000132330   Transcript: ENST00000412508
Sequence length 196
Comment pep:novel chromosome:GRCh38:2:238061054:238098219:1 gene:ENSG00000132330 transcript:ENST00000412508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XMEAAVAPGRDAPAPAASQPSGCGKHNSPERKVYMDYNATTPLEPEVIQAMTKAMWEAWG
NPSSPYSAGRKAKDIINAARESLAKMIGGKPQDIIFTSGGTEAAELVTQNCEAYEAHMRD
VRDYLEERLEAEFGQKRIHLNSQFPGTQRLPNTCNFSIRGPRLQGHVVLAQCRVLMASVG
AACHSDHGDQPSPVLL
Download sequence
Identical sequences ENSP00000416344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]