SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000419423 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000419423
Domain Number 1 Region: 2-88
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.08e-19
Family GABA-aminotransferase-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000419423   Gene: ENSG00000023330   Transcript: ENST00000459884
Sequence length 117
Comment pep:putative chromosome:GRCh38:3:52211452:52212507:1 gene:ENSG00000023330 transcript:ENST00000459884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRRQHQRNVKLMRQMLMDAGLPVVHCPSHIIPVRVADAAKNTEVCDELMSRHNIYVQAIN
YPTVPRGEELLRIAPTPHHTPQMMNYFLGEYLGSCWCLTEELHKAVFAVFIIEALQR
Download sequence
Identical sequences H7C5B0
ENSP00000419423 ENSP00000419423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]