SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000420476 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000420476
Domain Number 1 Region: 1-52
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-25
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420476   Gene: ENSG00000203326   Transcript: ENST00000491101
Sequence length 119
Comment pep:putative chromosome:GRCh38:19:53365704:53376442:1 gene:ENSG00000203326 transcript:ENST00000491101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLGSCCAVEVGLDLL
GSRHPPRPPKKLGLQAPTPVPNYWLLFLNFLHMCVLRANMSLLWTTSSWFLLIESVFAF
Download sequence
Identical sequences E7EUL5
ENSP00000420476 ENSP00000420476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]