SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000420909 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000420909
Domain Number 1 Region: 62-158,305-380
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 3.79e-18
Family Calcium ATPase, transmembrane domain M 0.052
Further Details:      
 
Domain Number 2 Region: 160-227,263-300
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.75e-16
Family Calcium ATPase, transduction domain A 0.0068
Further Details:      
 
Domain Number 3 Region: 409-462
Classification Level Classification E-value
Superfamily HAD-like 0.00000241
Family Meta-cation ATPase, catalytic domain P 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420909   Gene: ENSG00000145246   Transcript: ENST00000504445
Sequence length 535
Comment pep:novel chromosome:GRCh38:4:47485299:47547564:1 gene:ENSG00000145246 transcript:ENST00000504445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEALQWARYHWRRLIRGATRDDDSGPYNYSSLLACGRKSSQTPKLSGRHRIVVPHIQPF
KDEYEKFSGAYVNNRIRTTKYTLLNFVPRNLFEQFHRAANLYFLFLVVLNWVPLVEAFQK
EITMLPLVVVLTIIAIKDGLEDYRKYKIDKQINNLITKVYSRKEKKYIDRCWKDVTVGDF
IRLSCNEVIPADMVLLFSTDPDGICHIETSGLDGESNLKQRQVVRGYAEQDSEVDPEKFS
SRIECESPNNDLSRFRGFLEHSNKERVGLSKENLLLRGCTIRNTEAVVGIVVYAGHETKA
MLNNSGPRYKRSKLERRANTDVLWCVMLLVIMCLTGAVGHGIWLSRYEKMHFFNVPEPDG
HIISPLLAGFYMFWTMIILLQLGQIYFIQSDVDFYNEKMDSIVQCRALNIAEDLGQIQYL
FSDKTGTLTENKMVFRRCSVAGFDYCHEENARRLESYQEAVSEDEDFIDTVSGSLSNMAK
PRAPSCRTVHNGPLGNKPSNHLAGSSFTLGSGEGASEVPHSRQAAFSSPIVSMNA
Download sequence
Identical sequences Q6PEW3
ENSP00000420909 ENSP00000420909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]