SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000421810 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000421810
Domain Number 1 Region: 22-114
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.12e-21
Family GABA-aminotransferase-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000421810   Gene: ENSG00000175309   Transcript: ENST00000476170
Sequence length 123
Comment pep:putative chromosome:GRCh38:5:178228125:178232571:-1 gene:ENSG00000175309 transcript:ENST00000476170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAADQRPKADTLALRQRLISSSCRLFFPEDPVKIVRAQGQYMYDEQGAEYIDCISNVAHV
GHCHPLVVQAAHEQNQVLNTNSRYLHDNIVDYAQRLSETLPEQLCVFYFLNSGWGNSSSK
KGT
Download sequence
Identical sequences D6RAR0
ENSP00000421810 ENSP00000421810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]