SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000422738 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000422738
Domain Number 1 Region: 35-109
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.75e-16
Family Inorganic pyrophosphatase 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000422738   Gene: ENSG00000138777   Transcript: ENST00000513649
Sequence length 113
Comment pep:known chromosome:GRCh38:4:105438015:105474059:-1 gene:ENSG00000138777 transcript:ENST00000513649 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MSALLRLLRTGAPAAACLRLGTSAGTGSRRAMALYHTEERGQPCSQNYRLFFKNVTGHYI
SPFHDIPLKVNSKEENGIPMKKARNDEYENLFNMIVEIPRWTNAKMEVLKIAM
Download sequence
Identical sequences A0A2I2Y6A0 A0A2I3TKQ5 A0A2J8XQL7 D6RAD3
ENSP00000422738 ENSP00000422738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]