SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000423806 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000423806
Domain Number 1 Region: 10-59
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.0000012
Family GABA-aminotransferase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000423806   Gene: ENSG00000175309   Transcript: ENST00000474052
Sequence length 65
Comment pep:known chromosome:GRCh38:5:178208587:178232790:-1 gene:ENSG00000175309 transcript:ENST00000474052 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAADQRPKADTLALRQRLISSSCRLFFPEDPVKIVRAQGQYMYDEQGAEYIDCISNVAHV
RITAT
Download sequence
Identical sequences A0A2J8SD31 D6RCB8
ENSP00000423806 ENSP00000423806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]