SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000423843 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000423843
Domain Number 1 Region: 8-178
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.52e-23
Family AAT-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000423843   Gene: ENSG00000109576   Transcript: ENST00000502392
Sequence length 180
Comment pep:known chromosome:GRCh38:4:170073250:170091699:-1 gene:ENSG00000109576 transcript:ENST00000502392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKT
IQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQG
LCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKP
Download sequence
Identical sequences A0A2J8R349 D6RC56
ENSP00000423843 ENSP00000423843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]