SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000424608 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000424608
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.45e-21
Family GABA-aminotransferase-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000424608   Gene: ENSG00000175309   Transcript: ENST00000510913
Sequence length 115
Comment pep:known chromosome:GRCh38:5:178222476:178230073:-1 gene:ENSG00000175309 transcript:ENST00000510913 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
QAAHEQNQVLNTNSRYLHDNIVDYAQRLSETLPEQLCVFYFLNSGSEANDLALRLARHYT
GHQDVVVLDHAYHGHLSSLIDISPYKFRNLDGQKEWVHVVCTAQLNNSDMLSSLG
Download sequence
Identical sequences A0A2J8JTV5 H0Y9N3
ENSP00000424608 ENSP00000424608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]