SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000425067 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000425067
Domain Number 1 Region: 16-220
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.61e-35
Family AAT-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000425067   Gene: ENSG00000109576   Transcript: ENST00000510340
Sequence length 220
Comment pep:putative chromosome:GRCh38:4:170070619:170089394:-1 gene:ENSG00000109576 transcript:ENST00000510340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSVQMGVQWRGPADILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMK
RALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMII
NPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKN
TPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIE
Download sequence
Identical sequences D6REB9
ENSP00000425067 ENSP00000425067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]