SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000426525 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000426525
Domain Number 1 Region: 1-68
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.6e-20
Family GABA-aminotransferase-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000426525   Gene: ENSG00000164089   Transcript: ENST00000510723
Sequence length 70
Comment pep:putative chromosome:GRCh38:4:108756442:108762717:-1 gene:ENSG00000164089 transcript:ENST00000510723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHCHPGVVKAALKQMELLNTNSRFLHDNIVEYAKRLSATLPEKLSVCYFTNSGSEANDL
ALRLARQFRG
Download sequence
Identical sequences A0A2J8M2F1 D6RFL9
ENSP00000426525 ENSP00000426525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]