SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000426755 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000426755
Domain Number 1 Region: 38-174
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 2.82e-21
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000426755   Gene: ENSG00000138823   Transcript: ENST00000506883
Sequence length 178
Comment pep:known chromosome:GRCh38:4:99563828:99591239:1 gene:ENSG00000138823 transcript:ENST00000506883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARAPLRPENTIVRGSANQCQDTYRAEELTGHTTGLSLNNDRLYKLTYSTEVLLDRGKGK
LQDSVGYRISSNVDVALLWRNPDGDDDQLIQITMKDVNVENVNQQRGEKSIFKGKSPSKI
MGKENLEALQRPTLLHLIHGKVKEFYSYQNEAVAIENIKRGLASLFQTQLSSGTTNEV
Download sequence
Identical sequences D6REL9
ENSP00000426755 ENSP00000426755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]