SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000426978 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000426978
Domain Number 1 Region: 2-94
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.66e-34
Family Non-canonical RBD domain 0.0001
Further Details:      
 
Domain Number 2 Region: 98-252
Classification Level Classification E-value
Superfamily L domain-like 2.72e-32
Family mRNA export factor tap 0.00000362
Further Details:      
 
Domain Number 3 Region: 264-347
Classification Level Classification E-value
Superfamily NTF2-like 0.0000000000000643
Family NTF2-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000426978   Gene: ENSG00000126952   Transcript: ENST00000473265
Sequence length 365
Comment pep:known chromosome:GRCh38:X:101832198:101843199:-1 gene:ENSG00000126952 transcript:ENST00000473265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRNTQDENMRKWFKVTIPYGIKYDKAWLMNSIQSNCSVPFTPVDFHYIRNRACFFVQVA
SAASALKDVSYKIYDDENQKICIFVSHFTAPYSVKNKLKPGQMEMLKLTMNKRYNVSQQA
LDLQNLRFDPDLMGRDIDIILNRRNCMAATLKITERNFPELLSLNLCNNKLYQLDGLSDI
TEKAPKVKTLNLSKNKLESAWELGKVKGLKLEELWLEGNPLCSTFSDQSAYVSAIRDCFP
KLLRLDGRELSAPVIVDIDSSETMKPCKENFTGSETLKHLVLQFLQQSNLCKYFKDSRNI
KILKDPYLQRKLLKHTKCPRNVDSLSALPETQHDFTSILVDMWYQTVNTCFLPRAGPESQ
SLRPL
Download sequence
Identical sequences NP_116564.2.87134 NP_116564.2.92137 gi|254039592|ref|NP_116564.2| ENSP00000426978 ENSP00000426978 ENSP00000442401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]