SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000429240 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000429240
Domain Number 1 Region: 219-412
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.3e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.00000142
Further Details:      
 
Domain Number 2 Region: 122-185
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000000000000811
Family CRAL/TRIO domain 0.0042
Further Details:      
 
Domain Number 3 Region: 14-98
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000196
Family CRAL/TRIO domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429240   Gene: ENSG00000248405   Transcript: ENST00000517296
Sequence length 464
Comment pep:known chromosome:GRCh38:22:44702502:44862784:1 gene:ENSG00000248405 transcript:ENST00000517296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGQDPALSTSHPFYDVARHGILQVAGDDRFGRRVVTFSCCRMPPSHELDHQRLLEYLKY
TLDQYVENDYTIVYFHYGLNSRNKPSLGWLQSAYKEFDRKDGDLTMWPRLVSNSKLKRSS
HLSLPKYWDYRYKKNLKALYVVHPTSFIKVLWNILKPLISHKFGKKVIYFNYLSELHEHL
KYDQLVIPPEVLRYDEKLQSLHEGRTPPPTKTPPPRPPLPTQQFGVSLQYLKDKNQGELI
PPVLRFTVTYLREKGLRTEGLFRRSASVQTVREIQRLYNQGKPVNFDDYGDIHIPAVILK
TFLRELPQPLLTFQAYEQILGITCVESSLRVTGCRQILRSLPEHNYVVLRYLMGFLHAVS
RESIFNKMNSSNLACVFGLNLIWPSQGVSSLSALVPLNMFTELLIEYYEKIFSTPEAPGE
HGLAPWEQGSRAAPLQEAVPRTQATGLTKPTLPPSPLMAARRRL
Download sequence
Identical sequences P85298
ENSP00000374424 NP_001017526.1.87134 NP_001017526.1.92137 ENSP00000374424 ENSP00000429240 gi|66346662|ref|NP_001017526.1| 9606.ENSP00000374424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]