SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000429558 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000429558
Domain Number 1 Region: 2-98
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00000000000000378
Family AAT-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429558   Gene: ENSG00000169154   Transcript: ENST00000518826
Sequence length 121
Comment pep:putative chromosome:GRCh38:8:37934979:37936813:-1 gene:ENSG00000169154 transcript:ENST00000518826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVVVAVNNQQLLCVLSQLEGLAQALWLNPPNTGARVITSILCNPALLGEWKQSLKEVVE
NIMLTKEKVKEKLQLLGTPGSWGHITEQSGTHGYLGLNCKGLGGWCPPFLTFGLYLSIKL
H
Download sequence
Identical sequences E5RI59
ENSP00000429558 ENSP00000429558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]