SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000430453 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000430453
Domain Number 1 Region: 70-161
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.0000000000000911
Family AAT-like 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000430453   Gene: ENSG00000169154   Transcript: ENST00000524298
Sequence length 168
Comment pep:putative chromosome:GRCh38:8:37937638:37940103:-1 gene:ENSG00000169154 transcript:ENST00000524298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVPLAHKLEGSLLKTYKQDDYPNKIFLAYRGTFPQPHGVQERFVCRLSAELSPGGPNQA
SGAPSVVFLTVCMTNEGHPWVSLVVQKTRLQISQDPSLNYEYLPTMGLKSFIQASLALLF
GKHSQAIVENRVGGVHTVGDSGAFQLGVQFLRAWHKDARIVYIISSQK
Download sequence
Identical sequences E5RJX9
ENSP00000430453 ENSP00000430453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]